Sign In
Get Started →
What are some of Jacob Biehler’s interests or hobbies?
Profile Image for Jacob Biehler

Jacob Biehler

Full-stack software engineer
San Diego, California, United States
SummaryAI Assisted Badge

Jacob Biehler is a software engineer based in San Diego with experience in the defense contracting industry.

He specializes in Python, Flask, GraphQL, PostgreSQL, and Redis, as well as JavaScript/TypeScript with React and Redux.

Jacob has also worked on Node.js/TypeScript backends using hapi.js and sequelize.js.

Apart from software development, he is interested in Linux, game development, and DevOps, demonstrating a passion for continuous learning and exploring new opportunities.

His educational background includes studies in German Language and Literature, Business Administration, Management, Economics, and Oceanography.

Jacob has worked as a Software Engineer at Epsilon C5I and previously held roles at Moebius Solutions, Inc., ScoreShuttle, and Cubic Global Defense.

Tags
software engineerpythongame developmentdevopsjavascriptreactnode.jslinuxcontinuous learningredisreduxpostgresqltypescriptflaskgraphqlhapi.js
This public profile is provided courtesy of Clay. All information found here is in the public domain.
This public profile is provided courtesy of Clay. All information found here is in the public domain.