Ian HessSan Francisco Bay Area, United States
Social
Summary

Ian Hess is a distinguished Technical Account Manager with extensive experience in various software security firms. Currently, he is a Technical Account Manager at PayPal, where he is responsible for wearing "many hats", which include providing training and technical support for the company's product.

Having worked at esteemed companies such as Simility, RiskIQ, WhiteHat Security, Commtouch, and Tumbleweed/Axway, Ian has an impressive track record of success. His professional journey began with working at AirWave Wireless, where he served as a Software QA Engineer. Later on, he worked as a Tier 2 Support Engineer at Axway before transitioning to the Support and Sales Engineer role at Commtouch.

After that, Ian worked at WhiteHat Security, where he took up several roles, including Technical Specialist, CS Manager, and Director of Customer Success. He has a wealth of experience working in different organizations and holding various positions, which makes him an excellent asset to any team.

Ian's educational background is impressive as well. He studied at California State University-Sacramento, where he gained the skills and knowledge necessary to excel in his career.

technical account managersoftware securitypaypalsimilityriskiqwhitehat securitycommtouchtumbleweedtechnical supporttraining
InfoThis public profile is provided courtesy of Clay. All information found here is in the public domain.
Get Started with ClayA thoughtfully designed relationship manager for macOS and iOS.
InfoThis public profile is provided courtesy of Clay. All information found here is in the public domain.