James ZhouNew York, New York, United States
Social
Summary

James Zhou is an experienced IT professional with a diverse background in system administration, network operations, and system architecture. With over 10 years of experience, he has a proven track record of providing innovative technology solutions and implementing complex and cost-effective strategies to improve organizational efficiency. Zhou studied BS in Computer Science at Rutgers University and continued his education by pursuing an MS in Operations and Information Technology from Worcester Polytechnic Institute. He has held various leadership positions in organizations such as MeetMe, News Corp, Dow Jones, Fox Digital Media, Beliefnet, Inc., Bose, and Raytheon. Zhou has developed a robust combination of technical, business, and financial skills that have made him a sought-after leader in the IT field.

it professionalsystem administrationnetwork operationssystem architecturetechnology solutionsorganizational efficiencyleadershipmeetmenews corpdow jonesfox digital mediabeliefnetincbose
InfoThis public profile is provided courtesy of Clay. All information found here is in the public domain.
Get Started with ClayA thoughtfully designed relationship manager for macOS and iOS.
InfoThis public profile is provided courtesy of Clay. All information found here is in the public domain.